settings Currency keyboard_arrow_down
GBPAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
menu
phone07468986066emailjlhomescents@gmail.com
shopping_cart Basket (0)
Special Offers
location_on
Spirit of Heaven Men
Spirit of Heaven Men

Spirit of Heaven Men

Product Code:  pOTh1uu
Product Description
Smells like Thierry Mugler - A* Men
WARM, CHARACTERFUL AND AROMATIC. The aromatic top notes of Spirit of Heaven Men are instantly uplifting. A heart of caramel floats through the fragrance, blending with top notes of pine and base notes of vanilla, for a sweet yet spicy perfume for men.
50ml Bottle
£6.50 inc. tax
Add to Cart Quantity
Product Details
Product Condition: New
Product Description
Featured Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i